PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009775010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 298aa    MW: 31939.4 Da    PI: 8.9347
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009775010.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.7e-3957115361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++++cprCds ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  XP_009775010.1  57 SESIRCPRCDSPNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNT 115
                     57899****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.3E-3259114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.26460114IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2560113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MIQELFAGNT TLIGGGGENI SKQSNTPSSS PLSSTSNSST LTTNIPAAAN ASSSSNSESI  60
RCPRCDSPNT KFCYYNNYNL TQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKNTNMSTT  120
SAAKSSAAKL KASLPSFLGG LEHEISNSNP FLFSSPQNQY PLISILRGNH QNLSFNADTC  180
HFPNSVAVKE EGKSIGVNSY NQLPNSLGFC SNLWKNNQQN GSIIGEIQSS GLQELYQRLK  240
ASTSRCYPDH APSLFGNTAS SSSMILESAP VGAGGELGFW NPSISTWSDL QTANGAYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265171e-57AC226517.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0056J19, complete sequence.
GenBankAC2327741e-57AC232774.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0056J10, complete sequence.
GenBankHG9754411e-57HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-57HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775010.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLM1AMF61e-109M1AMF6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000259841e-109(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-33DOF zinc finger protein 1